PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594136.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 342aa    MW: 38767.1 Da    PI: 4.6811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594136.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ +++ g+ R++k+c++rw +yl
   XP_013594136.1 14 RGRWTAEEDEILTNYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding55.61.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+e +v+++  lG++ W+ Ia +++ gRt++++k++w+++l
   XP_013594136.1  67 RGNITAEEEETIVKLHSHLGNR-WSHIATHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.489961IPR017930Myb domain
SuperFamilySSF466893.82E-2811108IPR009057Homeodomain-like
SMARTSM007171.8E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-221568IPR009057Homeodomain-like
CDDcd001672.06E-81661No hitNo description
PROSITE profilePS5129427.03362116IPR017930Myb domain
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2569116IPR009057Homeodomain-like
CDDcd001671.56E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTAE EDEILTNYIQ TNGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRRDLKRGNI TAEEEETIVK LHSHLGNRWS HIATHLPGRT DNEIKNYWNS HLSRKIYAFT  120
AVTGDEHSLK VDDLVLNKPP SSSLEAKNTN KIKKKKGRTS RSSMKKHKQM VTASQCLPQP  180
KELESEISEG WNSGNYEGKS LGAYEWLDGE IERLMSSFVW ECTSEEAVIS MNDDDPDQNK  240
VCESGDNVSC CVDLFEEEQG KLGSLQVDQD MNIEKEREES ILSSNSNESG DKDWWVGLCD  300
SSEVGFGIDD ELLGWEFQGG LTCQSDDLWD LSDFGEIQQV DI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3171400.0HQ317140.1 Brassica rapa subsp. rapa cultivar Tsuda MYB domain protein 111 (MYB111) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594136.10.0PREDICTED: transcription factor MYB12-like
SwissprotO222646e-75MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A078DDN10.0A0A078DDN1_BRANA; BnaC07g27140D protein
TrEMBLA0A0D3DC660.0A0A0D3DC66_BRAOL; Uncharacterized protein
STRINGBra037419.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-173myb domain protein 111